PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00332g09011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 326aa    MW: 36541.7 Da    PI: 4.7425
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00332g09011.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.3e-092562892255
                               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                  Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                +yp++ee+ +L++ +gL+ +q+ +WF N+R ++
  Niben101Scf00332g09011.1 256 WPYPTEEEKNRLSEITGLDPKQINNWFINQRKRH 289
                               58*****************************885 PP

2ELK30.39.7e-11209230122
                       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                               ELK+ L+rKYsgyL  L++EF+
  Niben101Scf00332g09011.1 209 ELKETLMRKYSGYLTILRKEFL 230
                               9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-185599IPR005540KNOX1
PfamPF037903.3E-205798IPR005540KNOX1
SMARTSM012568.3E-26104155IPR005541KNOX2
PfamPF037913.2E-25107154IPR005541KNOX2
PfamPF037895.1E-8209230IPR005539ELK domain
SMARTSM011889.8E-6209230IPR005539ELK domain
PROSITE profilePS5121310.423209229IPR005539ELK domain
PROSITE profilePS5007112.584229292IPR001356Homeobox domain
SMARTSM003893.6E-13231296IPR001356Homeobox domain
SuperFamilySSF466891.97E-19231302IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-26234295IPR009057Homeodomain-like
CDDcd000861.08E-12241293No hitNo description
PfamPF059204.4E-16249288IPR008422Homeobox KN domain
PROSITE patternPS000270267290IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MMDELSKLHS AIACSSNNNH VVGVLEHITG QQQEGPINNS SVDNNLEKAS LEMSDLIKAQ  60
IANHPLYPNL LSAYLQCRKV GAPQEMVSIL EEISKENHLI SSCHNTEIGT DPELDDFMES  120
YCAVLLKYKE ELSKPFDEAT TFLNNIESQL SSLCKENLTT TTSTTSFNSN NNYLSDEAGG  180
TSDEDLCCGE MEAADSAQES PANREGDNEL KETLMRKYSG YLTILRKEFL KKRKKGKLPK  240
DARTALLDWW NTHYRWPYPT EEEKNRLSEI TGLDPKQINN WFINQRKRHW RPSEDMKYAL  300
MEGVSSGSIA GSMYFDGAGG SGSIGT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224233LRKEFLKKRK
2230234KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016499152.10.0PREDICTED: homeobox protein knotted-1-like 1
RefseqXP_016499153.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-107KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLQ9SXV10.0Q9SXV1_TOBAC; KN1-type homeobox protein
STRINGPGSC0003DMT4000071591e-162(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.13e-77KNOTTED-like from Arabidopsis thaliana 2